Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ANP32A polyclonal antibody (A01)

  • Catalog # : H00008125-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant ANP32A.
  • Immunogen:
  • ANP32A (AAH07200, 1 a.a. ~ 249 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008125-A01
    Western Blot detection against Immunogen (53.5 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8125
  • Gene Name:
  • ANP32A
  • Gene Alias:
  • C15orf1,I1PP2A,LANP,MAPM,MGC119787,MGC150373,PHAP1,PHAPI,PP32
  • Gene Description:
  • acidic (leucine-rich) nuclear phosphoprotein 32 family, member A
  • Other Designations:
  • cerebellar leucine rich acidic nuclear protein,inhibitor-1 of protein phosphatase-2A,mapmodulin,putative human HLA class II associated protein I
  • RSS
  • YouTube
  • Linkedin
  • Facebook