Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Biomarker

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TCL1A purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00008115-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TCL1A protein.
  • Immunogen:
  • TCL1A (AAH14024.1, 1 a.a. ~ 114 a.a) full-length human protein.
  • Sequence:
  • MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • TCL1A MaxPab polyclonal antibody. Western Blot analysis of TCL1A expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TCL1A expression in transfected 293T cell line (H00008115-T01) by TCL1A MaxPab polyclonal antibody.

    Lane 1: TCL1A transfected lysate(12.54 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8115
  • Gene Name:
  • TCL1A
  • Gene Alias:
  • TCL1
  • Gene Description:
  • T-cell leukemia/lymphoma 1A
  • Other Designations:
  • T-cell lymphoma-1,T-cell lymphoma-1A
  • RSS
  • YouTube
  • Linkedin
  • Facebook