IFT88 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (38.21 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant IFT88.
Immunogen
IFT88 (NP_783195, 724 a.a. ~ 833 a.a) partial recombinant protein with GST tag.
Sequence
RLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (84)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — IFT88
Entrez GeneID
8100GeneBank Accession#
NM_175605Protein Accession#
NP_783195Gene Name
IFT88
Gene Alias
D13S1056E, DAF19, MGC26259, RP11-172H24.2, TG737, TTC10, hTg737
Gene Description
intraflagellar transport 88 homolog (Chlamydomonas)
Omim ID
600595Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the tetratrico peptide repeat (TPR) family. Mutations of a similar gene in mouse can cause polycystic kidney disease. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
TPR repeat protein 10|intraflagellar transport 88 homolog|polaris|probe hTg737 (polycystic kidney disease, autosomal recessive)|recessive polycystic kidney disease protein Tg737 homolog|tetratricopeptide repeat domain 10
-
Interactome
-
Disease
-
Publication Reference
-
Tg737 acts as a key driver of invasion and migration in liver cancer stem cells and correlates with poor prognosis in patients with hepatocellular carcinoma.
You N, Tan Y, Zhou L, Huang X, Wang W, Wang L, Wu K, Mi N, Li J, Zheng L.
Experimental Cell Research 2017 Jun; 358(2):217.
Application：IHC, WB-Tr, Human, Human hepatocellular carcinoma, MHCC97-H cells.
-
Disruption of intraflagellar protein transport in photoreceptor cilia causes Leber congenital amaurosis in humans and mice.
Boldt K, Mans DA, Won J, van Reeuwijk J, Vogt A, Kinkl N, Letteboer SJ, Hicks WL, Hurd RE, Naggert JK, Texier Y, den Hollander AI, Koenekoop RK, Bennett J, Cremers FP, Gloeckner CJ, Nishina PM, Roepman R, Ueffing M.
The Journal of Clinical Investigation 2011 Jun; 121(6):2169.
Application：IHC-Fr, IHC-P, WB-Tr, Human, Mouse, HEK 293T cells, Mouse retinal sections.
-
Tg737 acts as a key driver of invasion and migration in liver cancer stem cells and correlates with poor prognosis in patients with hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com