Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFT88 polyclonal antibody (A01)

  • Catalog # : H00008100-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IFT88.
  • Immunogen:
  • IFT88 (NP_783195, 724 a.a. ~ 833 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008100-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8100
  • Gene Name:
  • IFT88
  • Gene Alias:
  • D13S1056E,DAF19,MGC26259,RP11-172H24.2,TG737,TTC10,hTg737
  • Gene Description:
  • intraflagellar transport 88 homolog (Chlamydomonas)
  • Gene Summary:
  • This gene encodes a member of the tetratrico peptide repeat (TPR) family. Mutations of a similar gene in mouse can cause polycystic kidney disease. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • TPR repeat protein 10,intraflagellar transport 88 homolog,polaris,probe hTg737 (polycystic kidney disease, autosomal recessive),recessive polycystic kidney disease protein Tg737 homolog,tetratricopeptide repeat domain 10
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook