Product Browser

Last updated: 2017/6/18
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

YEATS4 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00008089-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human YEATS4 protein.
  • Immunogen:
  • YEATS4 (NP_006521.1, 1 a.a. ~ 227 a.a) full-length human protein.
  • Sequence:
  • MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of YEATS4 expression in transfected 293T cell line (H00008089-T02) by YEATS4 MaxPab polyclonal antibody.

    Lane 1: YEATS4 transfected lysate(24.97 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8089
  • Gene Name:
  • YEATS4
  • Gene Alias:
  • 4930573H17Rik,B230215M10Rik,GAS41,NUBI-1,YAF9
  • Gene Description:
  • YEATS domain containing 4
  • Gene Summary:
  • The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors. [provided by RefSeq
  • Other Designations:
  • NuMA binding protein 1,glioma-amplified sequence-41
  • RSS
  • YouTube
  • Linkedin
  • Facebook