Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SSPN MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00008082-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SSPN protein.
  • Immunogen:
  • SSPN (NP_005077.2, 1 a.a. ~ 243 a.a) full-length human protein.
  • Sequence:
  • MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SSPN expression in transfected 293T cell line (H00008082-T01) by SSPN MaxPab polyclonal antibody.

    Lane 1: SSPN transfected lysate(26.60 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of SSPN transfected lysate using anti-SSPN MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SSPN purified MaxPab mouse polyclonal antibody (B02P) (H00008082-B02P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8082
  • Gene Name:
  • SSPN
  • Gene Alias:
  • DAGA5,KRAG,NSPN,SPN1,SPN2,nanospan
  • Gene Description:
  • sarcospan (Kras oncogene-associated gene)
  • Gene Summary:
  • This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq
  • Other Designations:
  • K-ras oncogene-associated gene (sarcospan),Kirsten-ras associated,microspan,sarcospan
  • RSS
  • YouTube
  • Linkedin
  • Facebook