SSPN purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SSPN MaxPab polyclonal antibody. Western Blot analysis of SSPN expression in human colon.
Western Blot (Transfected lysate)
Western Blot analysis of SSPN expression in transfected 293T cell line (H00008082-T01) by SSPN MaxPab polyclonal antibody.
Lane 1: SSPN transfected lysate(26.73 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SSPN protein.
Immunogen
SSPN (NP_005077.2, 1 a.a. ~ 243 a.a) full-length human protein.
Sequence
MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SSPN MaxPab polyclonal antibody. Western Blot analysis of SSPN expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of SSPN expression in transfected 293T cell line (H00008082-T01) by SSPN MaxPab polyclonal antibody.
Lane 1: SSPN transfected lysate(26.73 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SSPN
Entrez GeneID
8082GeneBank Accession#
NM_005086.3Protein Accession#
NP_005077.2Gene Name
SSPN
Gene Alias
DAGA5, KRAG, NSPN, SPN1, SPN2, nanospan
Gene Description
sarcospan (Kras oncogene-associated gene)
Omim ID
601599Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq
Other Designations
K-ras oncogene-associated gene (sarcospan)|Kirsten-ras associated|microspan|sarcospan
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com