Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

USP5 polyclonal antibody (A01)

  • Catalog # : H00008078-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant USP5.
  • Immunogen:
  • USP5 (NP_003472, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008078-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • USP5 polyclonal antibody (A01), Lot # 051108JC01 Western Blot analysis of USP5 expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8078
  • Gene Name:
  • USP5
  • Gene Alias:
  • ISOT
  • Gene Description:
  • ubiquitin specific peptidase 5 (isopeptidase T)
  • Other Designations:
  • ubiquitin isopeptidase T,ubiquitin specific peptidase 5,ubiquitin specific protease 5 (isopeptidase T),ubiquitin-specific protease-5 (ubiquitin isopeptidase T)
  • RSS
  • YouTube
  • Linkedin
  • Facebook