Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTP4A2 (Human) Recombinant Protein (P01)

  • Catalog # : H00008073-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTP4A2 full-length ORF ( NP_536316.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008073-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8073
  • Gene Name:
  • PTP4A2
  • Gene Alias:
  • HH13,HH7-2,HU-PP-1,OV-1,PRL-2,PRL2,PTP4A,PTPCAAX2,ptp-IV1a,ptp-IV1b
  • Gene Description:
  • protein tyrosine phosphatase type IVA, member 2
  • Gene Summary:
  • The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants that encode two distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000003902,phosphatase of regenerating liver 2,protein tyrosine phosphatase IVA,protein tyrosine phosphatase IVA2
  • RSS
  • YouTube
  • Linkedin
  • Facebook