Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC25A16 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008034-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC25A16 partial ORF ( NP_689920.1, 59 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.99
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008034-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8034
  • Gene Name:
  • SLC25A16
  • Gene Alias:
  • D10S105E,GDA,GDC,HGT.1,MGC39851,ML7,hML7
  • Gene Description:
  • solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16
  • Gene Summary:
  • This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019707,OTTHUMP00000060736,solute carrier family 25, member 16
  • RSS
  • YouTube
  • Linkedin
  • Facebook