NCOA4 monoclonal antibody (M05), clone 1F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NCOA4.
Immunogen
NCOA4 (NP_005428, 505 a.a. ~ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Isotype
IgG1 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NCOA4 monoclonal antibody (M05), clone 1F11 Western Blot analysis of NCOA4 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NCOA4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NCOA4 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NCOA4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NCOA4
Entrez GeneID
8031GeneBank Accession#
NM_005437Protein Accession#
NP_005428Gene Name
NCOA4
Gene Alias
ARA70, DKFZp762E1112, ELE1, PTC3, RFG
Gene Description
nuclear receptor coactivator 4
Gene Ontology
HyperlinkGene Summary
This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq
Other Designations
ELE1/ret TK|OTTHUMP00000019601|OTTHUMP00000019603|RET-activating gene ELE1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Dynamic O-GlcNAcylation coordinates ferritinophagy and mitophagy to activate ferroptosis.
Fan Yu, Qianping Zhang, Hanyu Liu, Jinming Liu, Song Yang, Xiaofan Luo, Wei Liu, Hao Zheng, Qiqi Liu, Yunxi Cui, Guo Chen, Yanjun Li, Xinglu Huang, Xiyun Yan, Jun Zhou and Quan Chen.
Cell Discovery 2022 May; 8(1):40.
Application:WB, Human, U2OS cells.
-
Dynamic O-GlcNAcylation coordinates ferritinophagy and mitophagy to activate ferroptosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com