Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LHX3 polyclonal antibody (A01)

  • Catalog # : H00008022-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LHX3.
  • Immunogen:
  • LHX3 (NP_055379, 228 a.a. ~ 316 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008022-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8022
  • Gene Name:
  • LHX3
  • Gene Alias:
  • DKFZp762A2013,LIM3,M2-LHX3
  • Gene Description:
  • LIM homeobox 3
  • Gene Summary:
  • This gene encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • LIM homeobox protein 3,LIM/homeodomain protein LHX3,OTTHUMP00000022567,OTTHUMP00000022568
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook