NUP214 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NUP214 partial ORF ( NP_005076, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.41
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NUP214
Entrez GeneID
8021GeneBank Accession#
NM_005085Protein Accession#
NP_005076Gene Name
NUP214
Gene Alias
CAIN, CAN, D9S46E, MGC104525, N214
Gene Description
nucleoporin 214kDa
Gene Ontology
HyperlinkGene Summary
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene is a member of the FG-repeat-containing nucleoporins. The protein encoded by this gene is localized to the cytoplasmic face of the nuclear pore complex where it is required for proper cell cycle progression and nucleocytoplasmic transport. The 3' portion of this gene forms a fusion gene with the DEK gene on chromosome 6 in a t(6,9) translocation associated with acute myeloid leukemia and myelodysplastic syndrome. [provided by RefSeq
Other Designations
CAN protein, putative oncogene|OTTHUMP00000064563|nuclear pore complex protein Nup214|nucleoporin 214kD (CAIN)|p250
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com