NUP214 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant NUP214.
Immunogen
NUP214 (NP_005076, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag.
Sequence
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.78 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — NUP214
Entrez GeneID
8021GeneBank Accession#
NM_005085Protein Accession#
NP_005076Gene Name
NUP214
Gene Alias
CAIN, CAN, D9S46E, MGC104525, N214
Gene Description
nucleoporin 214kDa
Gene Ontology
HyperlinkGene Summary
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene is a member of the FG-repeat-containing nucleoporins. The protein encoded by this gene is localized to the cytoplasmic face of the nuclear pore complex where it is required for proper cell cycle progression and nucleocytoplasmic transport. The 3' portion of this gene forms a fusion gene with the DEK gene on chromosome 6 in a t(6,9) translocation associated with acute myeloid leukemia and myelodysplastic syndrome. [provided by RefSeq
Other Designations
CAN protein, putative oncogene|OTTHUMP00000064563|nuclear pore complex protein Nup214|nucleoporin 214kD (CAIN)|p250
-
Interactome
-
Disease
-
Publication Reference
-
Oxidative Stress Inhibits Nuclear Protein Export by Multiple Mechanisms That Target FG Nucleoporins and Crm1.
Crampton N, Kodiha M, Shrivastava S, Umar R, Stochaj U.
Molecular Biology of the Cell 2009 Dec; 20(24):5106.
Application:IF, IP-WB, Human, HeLa cells.
-
The N-terminal domain of the mammalian nucleoporin p62 interacts with other nucleoporins of the FXFG family during interphase.
Stochaj U, Banski P, Kodiha M, Matusiewicz N.
Experimental Cell Research 2006 Apr; 312(13):2490.
Application:WB, Human, HeLa cells.
-
Oxidative Stress Inhibits Nuclear Protein Export by Multiple Mechanisms That Target FG Nucleoporins and Crm1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com