Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BRD3 polyclonal antibody (A01)

  • Catalog # : H00008019-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BRD3.
  • Immunogen:
  • BRD3 (AAH32124, 418 a.a. ~ 556 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008019-A01
    Western Blot detection against Immunogen (41.29 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • BRD3 polyclonal antibody (A01), Lot # 060707JCS1 Western Blot analysis of BRD3 expression in U-2 OS ( Cat # L022V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8019
  • Gene Name:
  • BRD3
  • Gene Alias:
  • FLJ23227,FLJ41328,KIAA0043,ORFX,RING3L
  • Gene Description:
  • bromodomain containing 3
  • Gene Summary:
  • This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022724,RING3-like,bromodomain containing protein 3,bromodomain-containing 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook