NR4A3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NR4A3 partial ORF ( NP_008912, 414 a.a. - 521 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.62
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NR4A3
Entrez GeneID
8013GeneBank Accession#
NM_006981Protein Accession#
NP_008912Gene Name
NR4A3
Gene Alias
CHN, CSMF, MINOR, NOR1, TEC
Gene Description
nuclear receptor subfamily 4, group A, member 3
Omim ID
600542Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Four transcript variants encoding three distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022775|OTTHUMP00000022776|chondrosarcoma, extraskeletal myxoid, fused to EWS|mitogen induced nuclear orphan receptor|neuron derived orphan receptor|translocated in extraskeletal chondrosarcoma
-
Interactome
-
Disease
-
Publication Reference
-
DNA-dependent protein kinase (DNA-PK) permits vascular smooth muscle cell proliferation through phosphorylation of the orphan nuclear receptor NOR1.
Medunjanin S, Daniel JM, Weinert S, Dutzmann J, Burgbacher F, Brecht S, Bruemmer D, Kahne T, Naumann M, Sedding DG, Zuschratter W, Braun-Dullaeus RC.
Cardiovascular Research 2015 Jun; 106(3):488.
Application：IF, WB-Ti, WB-Tr, Human, Atherosclerotic tissue, VSMC .
-
DNA-dependent protein kinase (DNA-PK) permits vascular smooth muscle cell proliferation through phosphorylation of the orphan nuclear receptor NOR1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com