NR4A3 monoclonal antibody (M06), clone 1E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NR4A3.
Immunogen
NR4A3 (NP_008912, 414 a.a. ~ 521 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NR4A3 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NR4A3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NR4A3
Entrez GeneID
8013GeneBank Accession#
NM_006981Protein Accession#
NP_008912Gene Name
NR4A3
Gene Alias
CHN, CSMF, MINOR, NOR1, TEC
Gene Description
nuclear receptor subfamily 4, group A, member 3
Omim ID
600542Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Four transcript variants encoding three distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022775|OTTHUMP00000022776|chondrosarcoma, extraskeletal myxoid, fused to EWS|mitogen induced nuclear orphan receptor|neuron derived orphan receptor|translocated in extraskeletal chondrosarcoma
-
Interactome
-
Disease
-
Publication Reference
-
Upregulation of NOR-1 in calcified human vascular tissues: impact on osteogenic differentiation and calcification.
Carme Ballester-Servera, Laia Cañes, Judith Alonso, Lidia Puertas-Umbert, Paula Vázquez-Sufuentes, Manel Taurón, Elena Roselló-Díez, Francisco Marín, Cristina Rodríguez, José Martínez-González.
Translational Research 2023 Sep; S1931-5244(23):00144.
Application:IHC, WB, Human, Human aortic valves, Human valvular interstitial cells.
-
CD69-oxLDL ligand engagement induces Programmed Cell Death 1 (PD-1) expression in human CD4 + T lymphocytes.
María Jiménez-Fernández, Cristina Rodríguez-Sinovas, Laia Cañes, Carme Ballester-Servera, Alicia Vara, Silvia Requena, Hortensia de la Fuente, José Martínez-González, Francisco Sánchez-Madrid.
Cellular and Molecular Life Sciences : CMLS 2022 Aug; 79(8):468.
Application:IHC-P, WB-Ce, Human, Human artery.
-
Neuron-derived orphan receptor-1 modulates cardiac gene expression and exacerbates angiotensin II-induced cardiac hypertrophy.
Cañes L, Martí-Pàmies I, Ballester-Servera C, Herraiz-Martínez A, Alonso J, Galán M, Nistal JF, Muniesa P, Osada J, Hove-Madsen L, Rodríguez C, Martínez-González J.
Clinical Science 2020 Feb; 134(3):359.
Application:IHC-P, WB-Ce, WB-Ti, Mouse, Cardiomyocytes, Hearts.
-
The nuclear receptor NOR-1 modulates redox homeostasis in human vascular smooth muscle cells.
Alonso J, Cañes L, García-Redondo AB, de Frutos PG, Rodríguez C, Martínez-González J.
Journal of Molecular and Cellular Cardiology 2018 Sep; 122:23.
Application:IHC-P, WB-Tr, Human, Vascular smooth muscle cells, Coronary artery.
-
NOR-1/NR4A3 regulates the cellular inhibitor of apoptosis 2 (cIAP2) in vascular cells: role in the survival response to hypoxic stress.
Alonso J, Galán M, Martí-Pàmies I, Romero JM, Camacho M, Rodríguez C, Martínez-González J.
Scientific Reports 2016 Sep; 6:34056.
Application:WB, IHC-P, Human, Human arteries, vascular smooth muscle cell, HUVEC.
-
The nuclear receptor NOR-1 regulates the small muscle protein, X-linked (SMPX) and myotube differentiation.
Ferran B, Marti-Pamies I, Alonso J, Rodriguez-Calvo R, Aguilo S, Vidal F, Rodriguez C, Martinez-Gonzalez J.
Scientific Reports 2016 May; 6:25944.
Application:IF, Human, Human skeletal muscle myoblasts.
-
Over-expression of Neuron-derived Orphan Receptor-1 (NOR-1) exacerbates neointimal hyperplasia after vascular injury.
Rodriguez-Calvo R, Guadall A, Calvayrac O, Navarro MA, Alonso J, Ferran B, de Diego A, Muniesa P, Osada J, Rodriguez C, Martinez-Gonzalez J.
Human Molecular Genetics 2013 May; 22(10):1949.
Application:IHC,WB, Mouse, Mouse heart.
-
Upregulation of NOR-1 in calcified human vascular tissues: impact on osteogenic differentiation and calcification.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com