PSCA monoclonal antibody (M02), clone 1E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PSCA expression in transfected 293T cell line by PSCA monoclonal antibody (M02), clone 1E1.
Lane 1: PSCA transfected lysate(12.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSCA is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.77 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PSCA.
Immunogen
PSCA (NP_005663, 23 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (68)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.77 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PSCA expression in transfected 293T cell line by PSCA monoclonal antibody (M02), clone 1E1.
Lane 1: PSCA transfected lysate(12.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSCA is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — PSCA
Entrez GeneID
8000GeneBank Accession#
NM_005672Protein Accession#
NP_005663Gene Name
PSCA
Gene Alias
PRO232
Gene Description
prostate stem cell antigen
Omim ID
602470Gene Ontology
HyperlinkGene Summary
This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene has a nonsynonymous nucleotide polymorphism at its start codon. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com