MYST3 monoclonal antibody (M07), clone 4D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MYST3.
Immunogen
MYST3 (NP_006757, 81 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (89)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MYST3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYST3 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — MYST3
Entrez GeneID
7994GeneBank Accession#
NM_006766Protein Accession#
NP_006757Gene Name
MYST3
Gene Alias
KAT6A, MGC167033, MOZ, RUNXBP2, ZNF220
Gene Description
MYST histone acetyltransferase (monocytic leukemia) 3
Omim ID
601408Gene Ontology
HyperlinkOther Designations
Monocytic leukemia zinc finger protein|runt-related transcription factor binding protein 2|zinc finger protein 220
-
Interactome
-
Publication Reference
-
miR-339-3p inhibits cell growth and epithelial-mesenchymal transition in nasopharyngeal carcinoma by modulating the KAT6A/TRIM24 axis.
Pei Gao, Kun Zhao, Wuhao Lu, Liang Wang, Peng Zhang.
International Journal of Clinical Oncology 2022 Nov; 27(11):1684.
Application:WB, Human, 5-8F, CEN2, NP69, NPC, S18, SUNE-2 cells.
-
KAT6A, a novel regulator of β-catenin, promotes tumorigenicity and chemoresistance in ovarian cancer by acetylating COP1.
Wenxue Liu, Zhiyan Zhan, Meiying Zhang, Bowen Sun, Qiqi Shi, Fei Luo, Mingda Zhang, Weiwei Zhang, Yanli Hou, Xiuying Xiao, Yanxin Li, Haizhong Feng.
Theranostics 2021 Apr; 11(13):6278.
Application:IHC, WB-Ce, WB-Tr, Human, A2780, HeLa, HEY, HO8910, HO8910-PM cells, Human normal ovarian tissues, Human ovarian cancer, IOSE80, SKOV3 cells.
-
miR-339-3p inhibits cell growth and epithelial-mesenchymal transition in nasopharyngeal carcinoma by modulating the KAT6A/TRIM24 axis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com