JTV1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human JTV1 full-length ORF ( NP_006294.2, 1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
61.7
Interspecies Antigen Sequence
Mouse (87); Rat (88)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — JTV1
Entrez GeneID
7965GeneBank Accession#
NM_006303.3Protein Accession#
NP_006294.2Gene Name
JTV1
Gene Alias
AIMP2, P38, PRO0992
Gene Description
JTV1 gene
Omim ID
600859Gene Ontology
HyperlinkGene Summary
The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown. [provided by RefSeq
Other Designations
ARS-interacting multi-functional protein 2
-
Interactome
-
Disease
-
Publication Reference
-
Fission yeast Asc1 stabilizes the interaction between eIF3a and Rps0A/uS2 for protein synthesis.
Wang YT, Chien YC, Hsiao WY, Wang CC, Wang SW.
Molecular and Cellular Biology 2019 Sep; 39(19):e00161.
Application：PI, WB-Re, Recombinant protein.
-
Fission yeast Asc1 stabilizes the interaction between eIF3a and Rps0A/uS2 for protein synthesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com