JTV1 monoclonal antibody (M02), clone 8E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
JTV1 monoclonal antibody (M02), clone 8E7. Western Blot analysis of JTV1 expression in K-562.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged JTV1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant JTV1.
Immunogen
JTV1 (NP_006294.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
JTV1 monoclonal antibody (M02), clone 8E7. Western Blot analysis of JTV1 expression in K-562.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged JTV1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — JTV1
Entrez GeneID
7965GeneBank Accession#
NM_006303Protein Accession#
NP_006294.2Gene Name
JTV1
Gene Alias
AIMP2, P38, PRO0992
Gene Description
JTV1 gene
Omim ID
600859Gene Ontology
HyperlinkGene Summary
The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown. [provided by RefSeq
Other Designations
ARS-interacting multi-functional protein 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com