Product Browser

Last updated: 2017/5/21
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPM2A polyclonal antibody (A01)

  • Catalog # : H00007957-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EPM2A.
  • Immunogen:
  • EPM2A (NP_001018051, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007957-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7957
  • Gene Name:
  • EPM2A
  • Gene Alias:
  • EPM2,MELF
  • Gene Description:
  • epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)
  • Gene Summary:
  • This gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017360,epilepsy, progressive myoclonus type 2, Lafora disease (laforin),laforin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook