Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD17B8 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007923-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HSD17B8 partial ORF ( NP_055049, 28 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007923-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7923
  • Gene Name:
  • HSD17B8
  • Gene Alias:
  • D6S2245E,FABG,FABGL,H2-KE6,HKE6,KE6,RING2,SDR30C1,dJ1033B10.9
  • Gene Description:
  • hydroxysteroid (17-beta) dehydrogenase 8
  • Gene Summary:
  • In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq
  • Other Designations:
  • 17-beta-HSD 8,17-beta-hydroxysteroid dehydrogenase 8,OTTHUMP00000029153,beta-ketoacyl-[acyl-carrier-protein] reductase-like,estradiol 17 beta-dehydrogenase 8,estrogen 17-oxidoreductase,short chain dehydrogenase/reductase family 30C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook