HSD17B8 monoclonal antibody (M01), clone 4F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HSD17B8 monoclonal antibody (M01), clone 4F1. Western Blot analysis of HSD17B8 expression in human pancreas.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSD17B8 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HSD17B8.
Immunogen
HSD17B8 (NP_055049, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (82)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HSD17B8 monoclonal antibody (M01), clone 4F1. Western Blot analysis of HSD17B8 expression in human pancreas.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSD17B8 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — HSD17B8
Entrez GeneID
7923GeneBank Accession#
NM_014234Protein Accession#
NP_055049Gene Name
HSD17B8
Gene Alias
D6S2245E, FABG, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1, dJ1033B10.9
Gene Description
hydroxysteroid (17-beta) dehydrogenase 8
Omim ID
601417Gene Ontology
HyperlinkGene Summary
In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq
Other Designations
17-beta-HSD 8|17-beta-hydroxysteroid dehydrogenase 8|OTTHUMP00000029153|beta-ketoacyl-[acyl-carrier-protein] reductase-like|estradiol 17 beta-dehydrogenase 8|estrogen 17-oxidoreductase|short chain dehydrogenase/reductase family 30C, member 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com