BAT1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant BAT1.
Immunogen
BAT1 (NP_004631, 329 a.a. ~ 428 a.a) partial recombinant protein with GST tag.
Sequence
RYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BAT1 polyclonal antibody (A01), Lot # GTH0060529QCS1 Western Blot analysis of BAT1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — BAT1
Entrez GeneID
7919GeneBank Accession#
NM_004640Protein Accession#
NP_004631Gene Name
BAT1
Gene Alias
D6S81E, DDX39B, UAP56
Gene Description
HLA-B associated transcript 1
Omim ID
142560Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
Other Designations
56 kDa U2AF65-associated protein|ATP-dependent RNA helicase p47|DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B|DEAD-box protein UAP56|OTTHUMP00000029228|OTTHUMP00000029229|OTTHUMP00000035591|OTTHUMP00000035963|OTTHUMP00000035964|OTTHUMP00000035965|OTTHUMP0000
-
Interactome
-
Disease
-
Publication Reference
-
Murine leukemia virus uses TREX components for efficient nuclear export of unspliced viral transcripts.
Sakuma T, Tonne JM, Ikeda Y.
Viruses 2014 Mar; 6(3):1135.
Application:WB-Tr, Human, 293T, TE671 cells.
-
Proteins associated with the exon junction complex also control the alternative splicing of apoptotic regulators.
Michelle L, Cloutier A, Toutant J, Shkreta L, Thibault P, Durand M, Garneau D, Gendron D, Lapointe E, Couture S, Le Hir H, Klinck R, Elela SA, Prinos P, Chabot B.
Molecular and Cellular Biology 2011 Dec; 32(5):954.
Application:WB, Human, HEK 293, HeLa cells.
-
Requirement of UAP56, URH49, RBM15, and OTT3 in the expression of Kaposi sarcoma-associated herpesvirus ORF57.
Majerciak V, Deng M, Zheng ZM.
Virology 2010 Nov; 407(2):206.
Application:WB-Tr, Human, HEK 293, HeLa cells.
-
A dual reporter approach to quantify defects in mRNA processing.
Banerjee A, Sammarco MC, Ditch S, Grabczyk E.
Analytical Biochemistry 2009 Dec; 395(2):237.
Application:WB-Tr, Human, HEK 293 Flp-In T-REx cells.
-
Murine leukemia virus uses TREX components for efficient nuclear export of unspliced viral transcripts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com