Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C5orf18 monoclonal antibody (M04), clone 3G11

  • Catalog # : H00007905-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant C5orf18.
  • Immunogen:
  • C5orf18 (NP_005660, 113 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007905-M04
    Western Blot detection against Immunogen (33.66 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged REEP5 is 1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7905
  • Gene Name:
  • REEP5
  • Gene Alias:
  • C5orf18,D5S346,DP1,MGC70440,TB2
  • Gene Description:
  • receptor accessory protein 5
  • Other Designations:
  • deleted in polyposis 1,polyposis coli region hypothetical protein DP1,polyposis locus protein 1,receptor expression enhancing protein 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook