Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST8SIA4 (Human) Recombinant Protein (P01)

  • Catalog # : H00007903-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ST8SIA4 full-length ORF ( AAH27866, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.22
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007903-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7903
  • Gene Name:
  • ST8SIA4
  • Gene Alias:
  • MGC34450,MGC61459,PST,PST1,SIAT8D,ST8SIA-IV
  • Gene Description:
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  • Gene Summary:
  • The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase,alpha-2,8-sialyltransferase 8D,polysialyltransferase-1,sialyltransferase 8 (alpha-2, 8-polysialytransferase) D,sialyltransferase 8D (alpha-2, 8-polysialyltransferase)
  • RSS
  • YouTube
  • Linkedin
  • Facebook