Product Browser

Last updated: 2017/12/10
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST8SIA4 monoclonal antibody (M03), clone 1H5

  • Catalog # : H00007903-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant ST8SIA4.
  • Immunogen:
  • ST8SIA4 (AAH27866, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ST8SIA4 monoclonal antibody (M03), clone 1H5. Western Blot analysis of ST8SIA4 expression in human kidney.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7903
  • Gene Name:
  • ST8SIA4
  • Gene Alias:
  • MGC34450,MGC61459,PST,PST1,SIAT8D,ST8SIA-IV
  • Gene Description:
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  • Gene Summary:
  • The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase,alpha-2,8-sialyltransferase 8D,polysialyltransferase-1,sialyltransferase 8 (alpha-2, 8-polysialytransferase) D,sialyltransferase 8D (alpha-2, 8-polysialyltransferase)
  • RSS
  • YouTube
  • Linkedin
  • Facebook