ARMET monoclonal antibody (M01), clone 1D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARMET is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ARMET on HeLa cell . [antibody concentration 40 ug/ml]
Western Blot detection against Immunogen (33.33 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARMET.
Immunogen
ARMET (NP_006001.2, 116 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARMET is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ARMET on HeLa cell . [antibody concentration 40 ug/ml] -
Gene Info — ARMET
Entrez GeneID
7873GeneBank Accession#
NM_006010Protein Accession#
NP_006001.2Gene Name
ARMET
Gene Alias
ARP, MANF, MGC142148, MGC142150
Gene Description
arginine-rich, mutated in early stage tumors
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of a specific mutation changing the previously numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors. With the protein size correction, this codon is now identified as the initiation codon. [provided by RefSeq
Other Designations
arginine-rich protein
-
Interactome
-
Publication Reference
-
Mesencephalic astrocyte-derived neurotrophic factor reduces cell apoptosis via upregulating HSP70 in SHSY-5Y cells.
Sun H, Jiang M, Fu X, Cai Q, Zhang J, Yin Y, Guo J, Yu L, Jiang Y, Liu Y, Feng L, Nie Z, Fang J, Jin L.
Translational Neurodegeneration 2017 May; 6:12.
Application：WB, Human, SHSY-5Y cells.
-
Mesencephalic astrocyte-derived neurotrophic factor reduces cell apoptosis via upregulating GRP78 in SH-SY5Y cells.
Huang J, Chen C, Gu H, Li C, Fu X, Jiang M, Sun H, Xu J, Fang J, Jin L.
Cell Biology International 2016 Jul; 40(7):803.
Application：WB-Ce, Human, SH-SY5Y cells.
-
Mesencephalic astrocyte-derived neurotrophic factor reduces cell apoptosis via upregulating HSP70 in SHSY-5Y cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com