Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEMA3B (Human) Recombinant Protein (P01)

  • Catalog # : H00007869-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SEMA3B full-length ORF (BAC03823.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MYNSVLPTGGRPLFLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTSMQISSKRAVPAARRKEWRPQHVVLRRLVSSRAAGTQGVRRGGQQRLSGV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7869
  • Gene Name:
  • SEMA3B
  • Gene Alias:
  • FLJ34863,LUCA-1,SEMA5,SEMAA,SemA,semaV
  • Gene Description:
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B
  • Gene Summary:
  • The semaphorin/collapsin family of molecules plays a critical role in the guidance of growth cones during neuronal development. The secreted protein encoded by this gene family member is important in axonal guidance and has been shown to act as a tumor suppressor by inducing apoptosis. [provided by RefSeq
  • Other Designations:
  • semaphorin 3B,semaphorin A,semaphorin V
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook