Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BRPF1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007862-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BRPF1 partial ORF ( NP_001003694, 500 a.a. - 590 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.75
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007862-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7862
  • Gene Name:
  • BRPF1
  • Gene Alias:
  • BR140
  • Gene Description:
  • bromodomain and PHD finger containing, 1
  • Gene Summary:
  • The protein encoded by this gene is expressed ubiquitously and at the highest level in testes and spermatogonia. The protein is localized within nuclei, and it is very similar in structure to two zinc finger proteins, AF10 and AF17. It is suggested that these proteins form a family of regulatory proteins. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • bromodomain and PHD finger-containing protein 1,bromodomain-containing protein, 140kD,peregrin
  • RSS
  • YouTube
  • Linkedin
  • Facebook