PXDN (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PXDN partial ORF ( XP_056455, 1452 a.a. - 1561 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PXDN
Entrez GeneID
7837GeneBank Accession#
XM_056455Protein Accession#
XP_056455Gene Name
PXDN
Gene Alias
D2S448, D2S448E, KIAA0230, MG50, PRG2, PXN, VPO
Gene Description
peroxidasin homolog (Drosophila)
Omim ID
605158Gene Ontology
HyperlinkGene Summary
Drosophila peroxidasin is an extracellular matrix-associated peroxidase (Horikoshi et al., 1999 [PubMed 10441517]). It is expressed exclusively in hemocytes derived from head mesoderm at a very early stage of differentiation. Peroxidasin exists as a homotrimer with a unique hybrid structure that combines an enzymatically functional peroxidase domain with motifs that are typically found in extracellular matrix-associated proteins. It is a secreted protein that contains a secretory recognition sequence at its N terminus. Peroxidasin catalyzes hydrogen peroxide-driven radioiodination, oxidations, and the formation of dityrosine in vitro. It is also thought to function in extracellular matrix consolidation, phagocytosis, and defense.[supplied by OMIM
Other Designations
p53-responsive gene 2|peroxidasin homolog
-
Interactome
-
Disease
-
Publication Reference
-
Induction of functional xeno-free MSCs from human iPSCs via a neural crest cell lineage.
Daisuke Kamiya, Nana Takenaka-Ninagawa, Souta Motoike, Mikihito Kajiya, Teppei Akaboshi, Chengzhu Zhao, Mitsuaki Shibata, Sho Senda, Yayoi Toyooka, Hidetoshi Sakurai, Hidemi Kurihara, Makoto Ikeya.
NPJ Regenerative Medicine 2022 Sep; 7(1):47.
Application：Sub, Mouse, Mouse myoblasts.
-
Induction of functional xeno-free MSCs from human iPSCs via a neural crest cell lineage.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com