Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BTG2 polyclonal antibody (A01)

  • Catalog # : H00007832-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BTG2.
  • Immunogen:
  • BTG2 (NP_006754, 59 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007832-A01
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7832
  • Gene Name:
  • BTG2
  • Gene Alias:
  • MGC126063,MGC126064,PC3,TIS21
  • Gene Description:
  • BTG family, member 2
  • Gene Summary:
  • The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. [provided by RefSeq
  • Other Designations:
  • B-cell translocation gene 2,NGF-inducible anti-proliferative protein PC3,OTTHUMP00000033982,nerve growth factor-inducible anti-proliferative,pheochromacytoma cell-3
  • RSS
  • YouTube
  • Linkedin
  • Facebook