Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DAP3 polyclonal antibody (A01)

  • Catalog # : H00007818-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DAP3.
  • Immunogen:
  • DAP3 (NP_004623, 237 a.a. ~ 343 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7818
  • Gene Name:
  • DAP3
  • Gene Alias:
  • DAP-3,DKFZp686G12159,MGC126058,MGC126059,MRP-S29,MRPS29,bMRP-10
  • Gene Description:
  • death associated protein 3
  • Gene Summary:
  • Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that also participates in apoptotic pathways which are initiated by tumor necrosis factor-alpha, Fas ligand, and gamma interferon. This protein potentially binds ATP/GTP and might be a functional partner of the mitoribosomal protein S27. Splice variants that differ in the 5' UTR have been found for this gene; both variants encode the same protein. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000033480,OTTHUMP00000033481,death-associated protein 3,mitochondrial 28S ribosomal protein S29
  • RSS
  • YouTube
  • Linkedin
  • Facebook