BSND purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BSND MaxPab polyclonal antibody. Western Blot analysis of BSND expression in 293.
Western Blot (Transfected lysate)
Western Blot analysis of BSND expression in transfected 293T cell line (H00007809-T01) by BSND MaxPab polyclonal antibody.
Lane 1: BSND transfected lysate(35.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to BSND on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human BSND protein.
Immunogen
BSND (NP_476517.1, 1 a.a. ~ 320 a.a) full-length human protein.
Sequence
MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70); Rat (71)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BSND MaxPab polyclonal antibody. Western Blot analysis of BSND expression in 293.Western Blot (Transfected lysate)
Western Blot analysis of BSND expression in transfected 293T cell line (H00007809-T01) by BSND MaxPab polyclonal antibody.
Lane 1: BSND transfected lysate(35.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to BSND on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] -
Gene Info — BSND
Entrez GeneID
7809GeneBank Accession#
NM_057176.2Protein Accession#
NP_476517.1Gene Name
BSND
Gene Alias
BART, MGC119283, MGC119284, MGC119285
Gene Description
Bartter syndrome, infantile, with sensorineural deafness (Barttin)
Gene Ontology
HyperlinkGene Summary
This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness. [provided by RefSeq
Other Designations
OTTHUMP00000009804|barttin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com