LRP8 monoclonal antibody (M02), clone 1A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LRP8 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LRP8.
Immunogen
LRP8 (NP_004622, 83 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LRP8 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — LRP8
Entrez GeneID
7804GeneBank Accession#
NM_004631Protein Accession#
NP_004622Gene Name
LRP8
Gene Alias
APOER2, HSZ75190, MCI1
Gene Description
low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Gene Ontology
HyperlinkGene Summary
This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000010479|OTTHUMP00000010480|OTTHUMP00000010481|apolipoprotein E receptor 2|low density lipoprotein receptor-related protein 8
-
Interactome
-
Disease
-
Publication Reference
-
LRP8 activates STAT3 to induce PD-L1 expression in osteosarcoma.
Shiqin Zheng, Yuxi Wei, Yu Jiang, Yi Hao.
Tumori 2021 Jun; 107(3):238.
Application：WB-Ti, Human, Human osteosarcoma tissues.
-
LRP8 activates STAT3 to induce PD-L1 expression in osteosarcoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com