LRP8 monoclonal antibody (M01), clone 3H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LRP8.
Immunogen
LRP8 (NP_004622, 83 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LRP8 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — LRP8
Entrez GeneID
7804GeneBank Accession#
NM_004631Protein Accession#
NP_004622Gene Name
LRP8
Gene Alias
APOER2, HSZ75190, MCI1
Gene Description
low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Gene Ontology
HyperlinkGene Summary
This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000010479|OTTHUMP00000010480|OTTHUMP00000010481|apolipoprotein E receptor 2|low density lipoprotein receptor-related protein 8
-
Interactome
-
Disease
-
Publication Reference
-
PCSK9 is not involved in the degradation of LDL receptors and BACE1 in the adult mouse brain.
Liu M, Wu G, Baysarowich J, Kavana M, Addona GH, Bierilo KK, Mudgett JS, Pavlovic G, Sitlani A, Renger JJ, Hubbard BK, Fisher TS, Zerbinatti CV.
Journal of Lipid Research 2010 Sep; 51(9):2611.
Application:WB-Ti, Mouse, Mouse brains.
-
PCSK9 is not involved in the degradation of LDL receptors and BACE1 in the adult mouse brain.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com