Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LRP8 polyclonal antibody (A01)

  • Catalog # : H00007804-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LRP8.
  • Immunogen:
  • LRP8 (NP_004622, 83 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007804-A01
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7804
  • Gene Name:
  • LRP8
  • Gene Alias:
  • APOER2,HSZ75190,MCI1
  • Gene Description:
  • low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
  • Gene Summary:
  • This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000010479,OTTHUMP00000010480,OTTHUMP00000010481,apolipoprotein E receptor 2,low density lipoprotein receptor-related protein 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook