Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTP4A1 (Human) Recombinant Protein (P01)

  • Catalog # : H00007803-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTP4A1 full-length ORF ( AAH23975, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.77
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007803-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7803
  • Gene Name:
  • PTP4A1
  • Gene Alias:
  • DKFZp779M0721,HH72,PRL-1,PRL1,PTP(CAAX1),PTPCAAX1
  • Gene Description:
  • protein tyrosine phosphatase type IVA, member 1
  • Gene Summary:
  • The protein encoded by this gene belongs to a small class of prenylated protein tyrosine phosphatases (PTPs), which contains a PTP domain and a characteristic C-terminal prenylation motif. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This tyrosine phosphatase is a nuclear protein, but may primarily associate with plasma membrane. The surface membrane association of this protein depends on its C-terminal prenylation. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which implicated its role in the tumorigenesis. Studies in rat suggested that this gene may be an immediate-early gene in mitogen-stimulated cells. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016675,Protein tyrosine phosphatase IVA1,protein tyrosine phosphatase type IVA protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook