PTP4A1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PTP4A1 expression in transfected 293T cell line (H00007803-T01) by PTP4A1 MaxPab polyclonal antibody.
Lane 1: PTP4A1 transfected lysate(19.03 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PTP4A1 protein.
Immunogen
PTP4A1 (NP_003454.1, 1 a.a. ~ 173 a.a) full-length human protein.
Sequence
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PTP4A1 expression in transfected 293T cell line (H00007803-T01) by PTP4A1 MaxPab polyclonal antibody.
Lane 1: PTP4A1 transfected lysate(19.03 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PTP4A1
Entrez GeneID
7803GeneBank Accession#
NM_003463.3Protein Accession#
NP_003454.1Gene Name
PTP4A1
Gene Alias
DKFZp779M0721, HH72, PRL-1, PRL1, PTP(CAAX1), PTPCAAX1
Gene Description
protein tyrosine phosphatase type IVA, member 1
Omim ID
601585Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to a small class of prenylated protein tyrosine phosphatases (PTPs), which contains a PTP domain and a characteristic C-terminal prenylation motif. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This tyrosine phosphatase is a nuclear protein, but may primarily associate with plasma membrane. The surface membrane association of this protein depends on its C-terminal prenylation. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which implicated its role in the tumorigenesis. Studies in rat suggested that this gene may be an immediate-early gene in mitogen-stimulated cells. [provided by RefSeq
Other Designations
OTTHUMP00000016675|Protein tyrosine phosphatase IVA1|protein tyrosine phosphatase type IVA protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com