ZNF213 monoclonal antibody (M01), clone 5D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ZNF213 monoclonal antibody (M01), clone 5D7 Western Blot analysis of ZNF213 expression in A-431 ( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ZNF213 expression in transfected 293T cell line by ZNF213 monoclonal antibody (M01), clone 5D7.
Lane 1: ZNF213 transfected lysate(51.3 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZNF213 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZNF213.
Immunogen
ZNF213 (NP_004211, 133 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTLGF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (49)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ZNF213 monoclonal antibody (M01), clone 5D7 Western Blot analysis of ZNF213 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ZNF213 expression in transfected 293T cell line by ZNF213 monoclonal antibody (M01), clone 5D7.
Lane 1: ZNF213 transfected lysate(51.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZNF213 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]ELISA
-
Gene Info — ZNF213
Entrez GeneID
7760GeneBank Accession#
NM_004220Protein Accession#
NP_004211Gene Name
ZNF213
Gene Alias
CR53, ZKSCAN21
Gene Description
zinc finger protein 213
Omim ID
608387Gene Ontology
HyperlinkGene Summary
C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.[supplied by OMIM
Other Designations
putative transcription factor CR53
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com