ZNF180 monoclonal antibody (M01), clone 4F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZNF180 expression in transfected 293T cell line by ZNF180 monoclonal antibody (M01), clone 4F3.
Lane 1: ZNF180 transfected lysate(79.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF180 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZNF180.
Immunogen
ZNF180 (NP_037388.1, 176 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VAFTQRKAVIHERVCKSDETGEKSGLNSSLFSSPVIPIRNHFHKHVSHAKKWHLNAAVNSHQKINENETLYENNECGKPPQSIHLIQFTRTQTKDKSYGFSDRIQSFCHG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (39); Rat (44)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZNF180 expression in transfected 293T cell line by ZNF180 monoclonal antibody (M01), clone 4F3.
Lane 1: ZNF180 transfected lysate(79.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF180 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ZNF180
Entrez GeneID
7733GeneBank Accession#
NM_013256Protein Accession#
NP_037388.1Gene Name
ZNF180
Gene Alias
HHZ168
Gene Description
zinc finger protein 180
Omim ID
606740Gene Ontology
HyperlinkGene Summary
Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See MIM 604749 for additional information on zinc finger proteins.[supplied by OMIM
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com