ZNF174 monoclonal antibody (M01), clone 2D7-E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ZNF174.
Immunogen
ZNF174 (AAH00876, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (76)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.48 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ZNF174 monoclonal antibody (M01), clone 2D7-E9 Western Blot analysis of ZNF174 expression in SW-13 ( Cat # L005V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ZNF174 expression in transfected 293T cell line by ZNF174 monoclonal antibody (M01), clone 2D7-E9.
Lane 1: ZNF174 transfected lysate(26 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF174 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ZNF174 over-expressed 293 cell line, cotransfected with ZNF174 Validated Chimera RNAi ( Cat # H00007727-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF174 monoclonal antibody (M01), clone 2D7-E9 (Cat # H00007727-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to ZNF174 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ZNF174
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com