ZBTB16 monoclonal antibody (M01), clone 3A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZBTB16 expression in transfected 293T cell line by ZBTB16 monoclonal antibody (M01), clone 3A7.
Lane 1: ZBTB16 transfected lysate (Predicted MW: 11.11 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZBTB16 is approximately 1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TRAF2 and ZBTB16. HeLa cells were stained with anti-TRAF2 rabbit purified polyclonal 1:1200 and anti-ZBTB16 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZBTB16.
Immunogen
ZBTB16 (AAH29812, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZBTB16 expression in transfected 293T cell line by ZBTB16 monoclonal antibody (M01), clone 3A7.
Lane 1: ZBTB16 transfected lysate (Predicted MW: 11.11 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZBTB16 is approximately 1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TRAF2 and ZBTB16. HeLa cells were stained with anti-TRAF2 rabbit purified polyclonal 1:1200 and anti-ZBTB16 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — ZBTB16
Entrez GeneID
7704GeneBank Accession#
BC029812Protein Accession#
AAH29812Gene Name
ZBTB16
Gene Alias
PLZF, ZNF145
Gene Description
zinc finger and BTB domain containing 16
Omim ID
176797Gene Ontology
HyperlinkGene Summary
This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. [provided by RefSeq
Other Designations
Kruppel-like zinc finger protein|promyelocytic leukemia zinc finger protein|zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com