Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MKRN3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007681-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MKRN3 partial ORF ( NP_005655, 437 a.a. - 507 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.55
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007681-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7681
  • Gene Name:
  • MKRN3
  • Gene Alias:
  • D15S9,MGC88288,RNF63,ZFP127,ZNF127
  • Gene Description:
  • makorin ring finger protein 3
  • Gene Summary:
  • The protein encoded by this gene contains a RING (C3HC4) zinc finger motif and several C3H zinc finger motifs. This gene is intronless and imprinted, with expression only from the paternal allele. Disruption of the imprinting at this locus may contribute to Prader-Willi syndrome. An antisense RNA of unknown function has been found overlapping this gene. [provided by RefSeq
  • Other Designations:
  • zinc finger protein 127
  • RSS
  • YouTube
  • Linkedin
  • Facebook