Product Browser

Last updated: 2017/4/30
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MKRN3 polyclonal antibody (A01)

  • Catalog # : H00007681-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MKRN3.
  • Immunogen:
  • MKRN3 (NP_005655, 437 a.a. ~ 507 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007681-A01
    Western Blot detection against Immunogen (33.92 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7681
  • Gene Name:
  • MKRN3
  • Gene Alias:
  • D15S9,MGC88288,RNF63,ZFP127,ZNF127
  • Gene Description:
  • makorin ring finger protein 3
  • Gene Summary:
  • The protein encoded by this gene contains a RING (C3HC4) zinc finger motif and several C3H zinc finger motifs. This gene is intronless and imprinted, with expression only from the paternal allele. Disruption of the imprinting at this locus may contribute to Prader-Willi syndrome. An antisense RNA of unknown function has been found overlapping this gene. [provided by RefSeq
  • Other Designations:
  • zinc finger protein 127
  • RSS
  • YouTube
  • Linkedin
  • Facebook