Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZSCAN21 monoclonal antibody (M16), clone 4F10

  • Catalog # : H00007589-M16
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant ZSCAN21.
  • Immunogen:
  • ZSCAN21 (NP_666019, 136 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007589-M16
    Western Blot detection against Immunogen (35.42 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ZSCAN21 expression in transfected 293T cell line by ZNF38 monoclonal antibody (M16), clone 4F10.

    Lane 1: ZSCAN21 transfected lysate(50.9 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7589
  • Gene Name:
  • ZSCAN21
  • Gene Alias:
  • DKFZp434L134,DKFZp686H10254,NY-REN-21,ZNF38,Zipro1
  • Gene Description:
  • zinc finger and SCAN domain containing 21
  • Other Designations:
  • zinc finger protein 38,zinc finger protein 38 (KOX 25),zinc finger protein NY-REN-21 antigen
  • RSS
  • YouTube
  • Linkedin
  • Facebook