ZNF28 monoclonal antibody (M01), clone 8H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ZNF28 monoclonal antibody (M01), clone 8H6. Western Blot analysis of ZNF28 expression in Hela S3 NE.
Western Blot (Cell lysate)
ZNF28 monoclonal antibody (M01), clone 8H6. Western Blot analysis of ZNF28 expression in PC-12.
Western Blot (Cell lysate)
ZNF28 monoclonal antibody (M01), clone 8H6. Western Blot analysis of ZNF28 expression in NIH/3T3.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF28 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.9 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ZNF28.
Immunogen
ZNF28 (AAH70146.1, 1 a.a. ~ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGEDNLLGMCPCVSLYFLLLPLGSHILT
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.9 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ZNF28 monoclonal antibody (M01), clone 8H6. Western Blot analysis of ZNF28 expression in Hela S3 NE.Western Blot (Cell lysate)
ZNF28 monoclonal antibody (M01), clone 8H6. Western Blot analysis of ZNF28 expression in PC-12.Western Blot (Cell lysate)
ZNF28 monoclonal antibody (M01), clone 8H6. Western Blot analysis of ZNF28 expression in NIH/3T3.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF28 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — ZNF28
Entrez GeneID
7576GeneBank Accession#
BC070146.1Protein Accession#
AAH70146.1Gene Name
ZNF28
Gene Alias
DKFZp781D0275, KOX24
Gene Description
zinc finger protein 28
Gene Ontology
HyperlinkOther Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com