ZNF23 monoclonal antibody (M02), clone 2D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZNF23 expression in transfected 293T cell line by ZNF23 monoclonal antibody (M02), clone 2D3.
Lane 1: ZNF23 transfected lysate (Predicted MW: 73.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF23 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZNF23.
Immunogen
ZNF23 (NP_666016.1, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (48); Rat (51)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZNF23 expression in transfected 293T cell line by ZNF23 monoclonal antibody (M02), clone 2D3.
Lane 1: ZNF23 transfected lysate (Predicted MW: 73.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF23 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ZNF23
Entrez GeneID
7571GeneBank Accession#
NM_145911Protein Accession#
NP_666016.1Gene Name
ZNF23
Gene Alias
KOX16, MGC57283, ZNF359, ZNF612, Zfp612
Gene Description
zinc finger protein 23 (KOX 16)
Omim ID
194527Gene Ontology
HyperlinkOther Designations
OTTHUMP00000174921|kruppel-like zinc finger factor X31|zinc finger protein 23|zinc finger protein 32|zinc finger protein 359
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com