Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNF14 polyclonal antibody (A01)

  • Catalog # : H00007561-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ZNF14.
  • Immunogen:
  • ZNF14 (NP_066358, 70 a.a. ~ 161 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNRHMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSYHHCFRKHER
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007561-A01
    Western Blot detection against Immunogen (36.23 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ZNF14 polyclonal antibody (A01), Lot # 061110JCS1. Western Blot analysis of ZNF14 expression in Daoy.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7561
  • Gene Name:
  • ZNF14
  • Gene Alias:
  • GIOT-4,KOX6
  • Gene Description:
  • zinc finger protein 14
  • Gene Summary:
  • The protein encoded by this gene contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins. [provided by RefSeq
  • Other Designations:
  • gonadotropin inducible transcription repressor-4,zinc finger protein 14 (KOX 6),zinc finger protein KOX6
  • RSS
  • YouTube
  • Linkedin
  • Facebook