Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZIC1 monoclonal antibody (M04A), clone 1D12

  • Catalog # : H00007545-M04A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ZIC1.
  • Immunogen:
  • ZIC1 (NP_003403, 2 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007545-M04A
    Western Blot detection against Immunogen (36.08 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7545
  • Gene Name:
  • ZIC1
  • Gene Alias:
  • ZIC,ZNF201
  • Gene Description:
  • Zic family member 1 (odd-paired homolog, Drosophila)
  • Gene Summary:
  • This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene. [provided by RefSeq
  • Other Designations:
  • Zic family member 1 (odd-paired Drosophila homolog),Zinc finger protein of the cerebellum 1,zinc finger protein of the cerebellum 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook